PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0537s0200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 576aa    MW: 63461.3 Da    PI: 4.8771
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0537s0200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.5e-183986148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g+WT  Ed +l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  SapurV1A.0537s0200.1.p 39 KGPWTSAEDAILIEYVKKHGEGNWNSVQKHSGLLRCGKSCRLRWANHL 86
                            79******************************99**********9986 PP

2Myb_DNA-binding53.94.3e-1792135146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             +g++T+eE++l++++++++G++ W++ a++++ gRt++++k++w++
  SapurV1A.0537s0200.1.p  92 KGAFTQEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                             799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.9513486IPR017930Myb domain
SMARTSM007172.2E-153888IPR001005SANT/Myb domain
SuperFamilySSF466892.1E-3038133IPR009057Homeodomain-like
PfamPF002497.3E-163986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-244093IPR009057Homeodomain-like
CDDcd001674.45E-124186No hitNo description
PROSITE profilePS5129426.87287141IPR017930Myb domain
SMARTSM007172.3E-1791139IPR001005SANT/Myb domain
PfamPF002494.6E-1692135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2694140IPR009057Homeodomain-like
CDDcd001671.18E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MSRTTNECED GMISKDQTEL PLGEEGSYDE CTNGVVLKKG PWTSAEDAIL IEYVKKHGEG  60
NWNSVQKHSG LLRCGKSCRL RWANHLRPNL KKGAFTQEEE QLIIELHAKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP EVCLQASQGS QQCLDINRID SGNKGQHDVL  180
QTHNYGIPDV MFDNLRTNQS ILPYVPELPD ISASSVLMKG LCSSQHGSFM SPTMHRQKRL  240
RETTNLQSSF SGGMKNDFHV FDQFQDGDKA AQYFGLSFPF DPDSVAKNPE IFGENQGSHT  300
LANGNFSASK PTSEAVKLEL PSLQYAETDL GGWGASCSSS PLIESVDTFI QSPPTGTVES  360
NSPRNSGLLD ALLYEARTLS SAKNRSSDKS SNSSTITPGD DADCSVLNFS ETEWEDYGDP  420
ISPLCHPVTS LFRECTPISA SGSSLDESPP TETLTGSKHK FGCPAEYNMK SEPVDHTWTP  480
DREKESYTHL NITRPDALLD SDWLEHDSGY GKDQVIMPEA IAALLGDDLS SEYKQMDLSS  540
EYKQMDAGAS TGHGWGPGSC SWNNMPAVCQ MSEFP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-32371405107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0346481e-90KM034648.1 Jatropha curcas clone JcMYB028 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304822.20.0hypothetical protein POPTR_0003s18900g
RefseqXP_006385964.10.0hypothetical protein POPTR_0003s18900g
TrEMBLB9GXK60.0B9GXK6_POPTR; Uncharacterized protein
STRINGPOPTR_0003s18900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-128myb domain protein 33